Find Your Favorite Movies

Discover trending and top-rated movies easily.

Dracula 2000

Dracula 2000

The Most Seductive Evil of All Time Has Now Been Unleashed in Ours.

When a team of techno-savvy thieves break into a high-security vault, they don't discover priceless works of art... they find a crypt unopened for 100 years.

Where to Watch

You can check official streaming platforms for availability:

Movie Details

  • Original Title: Dracula 2000
  • Genres: Thriller, Horror, Action, Fantasy
  • Release Date: 2000-12-22
  • Runtime: 98 minutes
  • Rating: 5.2/10 (699 votes)
  • Budget: $28,000,000
  • Revenue: $47,053,625
  • Production Companies: Wes Craven Films, Dimension Films, Neo Art & Logic
  • Status: Released
  • Popularity: 1.8072
  • Languages: English

Cast & Crew

Gerard Butler

Gerard Butler

as Dracula

Christopher Plummer

Christopher Plummer

as Matthew Van Helsing

Jonny Lee Miller

Jonny Lee Miller

as Simon Sheppard

Justine Waddell

Justine Waddell

as Mary Heller

Vitamin C

Vitamin C

as Lucy Westerman

Jennifer Esposito

Jennifer Esposito

as Solina

Omar Epps

Omar Epps

as Marcus

Sean Patrick Thomas

Sean Patrick Thomas

as Trick

Danny Masterson

Danny Masterson

as Nightshade

Lochlyn Munro

Lochlyn Munro

as Eddie

Gallery

Movie sceneMovie sceneMovie sceneMovie sceneMovie sceneMovie sceneMovie sceneMovie sceneMovie sceneMovie scene

Trailers & Clips

Wes Craven Presents: Dracula 2000 - Trailer

External Links

Keywords

martial artslondon, englandfightvampirechristianitybitetransformationvampire hunter (slayer)punishmentwerewolfgothic horrorurban gothicdracula

Frequently Asked Questions

What is Dracula 2000?

Dracula 2000 is a Thriller, Horror, Action, Fantasy movie directed by . It was released on 2000-12-22.

Who are the main actors in Dracula 2000?

The main cast includes Gerard Butler, Christopher Plummer, Jonny Lee Miller, Justine Waddell, Vitamin C, .

Where can I watch Dracula 2000 online?

You can check official streaming platforms like Netflix, Amazon Prime, or Disney+ to see if Dracula 2000 is available.

Is Dracula 2000 based on a true story?

The Most Seductive Evil of All Time Has Now Been Unleashed in Ours.

What is the IMDb rating of Dracula 2000?

Dracula 2000 has an IMDb rating of 5.2/10 based on 699 votes.

What is the budget and revenue of Dracula 2000?

The movie had a production budget of $28,000,000 and earned $47,053,625 at the box office.

Who composed the soundtrack for Dracula 2000?

The soundtrack was composed by Wes Craven Films, Dimension Films, Neo Art & Logic. You can listen to it on music streaming platforms.

Where was Dracula 2000 filmed?

Dracula 2000 was filmed in multiple locations worldwide. You can find official filming locations on IMDb.

How long is Dracula 2000?

The total runtime of Dracula 2000 is 98 minutes.

Is Dracula 2000 suitable for kids?

The movie is rated Released. Please check parental guidelines before watching.

Will there be a sequel to Dracula 2000?

There is no official announcement yet for a sequel to Dracula 2000.

Does Dracula 2000 have a post-credit scene?

Some movies include post-credit scenes. Stay till the end to find out!

Similar Movies

Pixels

Pixels

Mat Kilau

Mat Kilau

The Flying Machine 3D

The Flying Machine 3D

Roald Dahl's The Witches

Roald Dahl's The Witches

No One Can Touch Her

No One Can Touch Her

A & E: When Patients Attack

A & E: When Patients Attack

Reyes

Reyes

Born Wild

Born Wild

Vengeance of the Zombies

Vengeance of the Zombies

The Knight of Shadows: Between Yin and Yang

The Knight of Shadows: Between Yin and Yang

Day of the Panther

Day of the Panther

The Rats Are Coming! The Werewolves Are Here!

The Rats Are Coming! The Werewolves Are Here!

The Devil's Wedding Night

The Devil's Wedding Night

Monsters

Monsters

The Human Centipede 2 (Full Sequence)

The Human Centipede 2 (Full Sequence)

My Heart Can't Beat Unless You Tell It To

My Heart Can't Beat Unless You Tell It To

Action Team Overlord Flower

Action Team Overlord Flower

1911

1911

The Veteran

The Veteran

First Target

First Target